PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc001068.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family ZF-HD
Protein Properties Length: 246aa    MW: 27257.6 Da    PI: 7.7077
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc001068.1_g00007.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer97.88.5e-3160112356
              ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRre 56 
                               v+Y eClkNhAa++Gg+a+DGCgEfmp+ ge+g+ +alkC+AC+CHRnFHR+ 
  Itr_sc001068.1_g00007.1  60 DVKYMECLKNHAAAMGGTATDGCGEFMPA-GEDGSLEALKCSACQCHRNFHRKL 112
                              689*************************9.999*******************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047702.3E-2761111IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257743.0E-2161111IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.5E-2962111IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.82163112IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.603.3E-29165238IPR009057Homeodomain-like
SuperFamilySSF466893.71E-18176237IPR009057Homeodomain-like
TIGRFAMsTIGR015652.6E-26179236IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MSQQNKKPLL SATGNASCSK HEEQEEEEHH NNIINGQMVP FVASSSSTME VIETHNRYND  60
VKYMECLKNH AAAMGGTATD GCGEFMPAGE DGSLEALKCS ACQCHRNFHR KLLIKGCPWA  120
RSCPLIFPCS QNKGATPVAY NNNNNNNNAS SGGGGGVVSD WEEKEDAAAE EEEGLEMRKK  180
RFRTKFSGEQ KEKMVAFAER VGWKIQKVDS SVVHNFCQEI GVKRRVLKVW MHNNKNSFAG  240
LSKPTN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A1e-241802371875ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003555538.14e-64PREDICTED: zinc-finger homeodomain protein 4-like
SwissprotQ9M9S06e-57ZHD4_ARATH; Zinc-finger homeodomain protein 4
TrEMBLA0A0B2PBF34e-64A0A0B2PBF3_GLYSO; ZF-HD homeobox protein
TrEMBLK7N4V54e-64K7N4V5_SOYBN; Uncharacterized protein
STRINGGLYMA20G35690.21e-63(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.22e-57homeobox protein 31